PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G061000.1
Common NameB456_009G061000, LOC105768958
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 660aa    MW: 72439.7 Da    PI: 5.8682
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G061000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.46.6e-28202255155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kpr++W+ eLH++Fv av+qL G+ekA+Pk+ilelm+v+ Lt+e+v+SHLQk+Rl
  Gorai.009G061000.1 202 KPRVVWSVELHRKFVAAVNQL-GIEKAVPKKILELMNVENLTRENVASHLQKFRL 255
                         79*******************.********************************8 PP

2Response_reg77.93.6e-26201281109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl vdD+p+ + ll+++l+k +y +v++++++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ e 
  Gorai.009G061000.1  20 VLAVDDDPTCLLLLETLLTKCKY-NVTTTSQAITALKMLRENKnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGDTKLVMEG 108
                         799********************.***************888888*******************87754.558****************** PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         +  Ga d+l Kp+ +eel +
  Gorai.009G061000.1 109 ITHGACDYLLKPVRIEELQN 128
                         *****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.2E-4117141No hitNo description
SuperFamilySSF521721.85E-3517141IPR011006CheY-like superfamily
SMARTSM004482.3E-3218130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.50519134IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.2E-2320128IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.84E-2421134No hitNo description
SuperFamilySSF466891.02E-19199259IPR009057Homeodomain-like
PROSITE profilePS5129411.88199258IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-29200260IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-24202255IPR006447Myb domain, plants
PfamPF002493.5E-6204253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MRVERVISDE NDSFPVGMRV LAVDDDPTCL LLLETLLTKC KYNVTTTSQA ITALKMLREN  60
KNKFDLVISD VHMPDMDGFK LLELVGLEMD LPVIMLSANG DTKLVMEGIT HGACDYLLKP  120
VRIEELQNIW QHVIRRKKFD RKDRDGSGSQ DKPYIDSSEA AGLGNVDHNG KFNKKRKDQN  180
EDEDEERDEN GHDNEDLSTQ KKPRVVWSVE LHRKFVAAVN QLGIEKAVPK KILELMNVEN  240
LTRENVASHL QKFRLYLKRI SCVANQQANM AAALGSVDST HLRMGTMNGL GNFHTLAGPD  300
QIHNAAFRSF QHSGVLRRLN TPAGVGISGL PSSGLVQLSP VQNLGNTSTY QRKLQSFVIP  360
GNHNANILQG MPMSLEFYQL QNNRAASHVG QFPSVDNTTV LPVSSISGSL IDAGCSNSPL  420
LGVTSNSLLL EGSSQLPTLH ASNLRDSVSG FPNRSTLSDF TSIAPASNQL HGSKADIQDQ  480
AFPISCNAGK IISSAPQDWN APKKDAPYQS NVPSCSINSL RAVNGDMAQL GQCLDQNNPI  540
FNRNVGFDFV DPLSIKCSEG ENLAMEPSVI EKEGYLMVQP SRQGIYIPDN EGENFAMEPS  600
VIEKEGYLIV QPRRQGSYIP GNLGSLEDLA SAMTKQDHDK GKPTDGDFGY NDYSLRTCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-26198261164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012444721.10.0PREDICTED: two-component response regulator ARR12-like
TrEMBLA0A0D2RV300.0A0A0D2RV30_G
STRINGPOPTR_0006s27800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19812879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-133response regulator 12
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]